PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv4_095190_rrar.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family STAT
Protein Properties Length: 646aa    MW: 71898.9 Da    PI: 6.5496
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv4_095190_rrar.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT152.11.4e-471532741122
                STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipk 91 
                         ldv+ll+alg+ v+k++evvasL+ya++ ++vek + +eapLL++++G+ef+s d+p+kll+Grasf+l is+Lss+c ++Lf++kf ++k
  Bv4_095190_rrar.t1 153 LDVLLLDALGEHVHKELEVVASLIYAENQAAVEKLKGDEAPLLTTCNGLEFPSDDKPSKLLQGRASFQLNISRLSSECADKLFHVKFYVLK 243
                         89***************************************************************************************** PP

                STAT  92 lkkypfleavskpirCisrsrntrsssltkk 122
                         +k++pf+ea++ pirCi ++ +++ s+ t+k
  Bv4_095190_rrar.t1 244 MKSFPFFEALTPPIRCILKTCDNKISTITWK 274
                         **********************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2002.2E-42668IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF498998.34E-52673IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.106.8E-4540580IPR000980SH2 domain
SuperFamilySSF555502.84E-5541606IPR000980SH2 domain
PROSITE profilePS500018.699547607IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 646 aa     Download sequence    Send to blast
MLSPCVLTHN ESSDSGGFVS LEKVPRAISN VEFPLGQWAH IGCQVYSNSI RIYLDGELVG  60
ESPLGSSMTK QGDSQCFTKV TLSAMCKGFE GLHGYVHNAI VLPSTSSIKD HHVKDPPLWL  120
SIDSSSASEI ELESDGVWKI VGGKASYRKM FSLDVLLLDA LGEHVHKELE VVASLIYAEN  180
QAAVEKLKGD EAPLLTTCNG LEFPSDDKPS KLLQGRASFQ LNISRLSSEC ADKLFHVKFY  240
VLKMKSFPFF EALTPPIRCI LKTCDNKIST ITWKKLPSGV HLFNGSSFPQ CGVGLSELQQ  300
KAVCEAIPSP PSKKKKLGRD TPLPVIKAAS YAQRPDEECS SHALSATKVQ NAVGTSLECI  360
QENYGGSDNS ASDTESVGAK KSELKNIPCK RELISDLTIF RYCLGGLSER SLMLKEISLY  420
SSEQEMAEMA EKVSFFSGCS HHRHQIMIAK KLFEEGEKAW NSISQNSNRV HWDNVVFEIE  480
EQFMKIASCS MRSLTQQDLN FLRSISGGHE YIIKDDFDKM WRWLYPVAFT ISRQGINALW  540
TSTSPKWIEG FVTKEEIEYA LQSPLGIQEP GTFILRFPTT RSWPHPDAGS LVASYVGRDF  600
SLHHRQLSLN YSSDIFDTNQ KPLQELLLSE PELSRVGRIT RSDLAI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010694739.10.0PREDICTED: uncharacterized protein LOC104907497
RefseqXP_010694738.10.0PREDICTED: uncharacterized protein LOC104907497
RefseqXP_010694737.10.0PREDICTED: uncharacterized protein LOC104907497
TrEMBLA0A0J8BB720.0A0A0J8BB72_BETVU; Uncharacterized protein
STRINGVIT_19s0014g00140.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.11e-176SH2 domain protein B